Return to main results Retrieve Phyre Job Id

Job DescriptionQ47138
Confidence2.93%DateThu Jan 5 12:36:15 GMT 2012
Rank82Aligned Residues47
% Identity23%Templatec3imkA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:putative molybdenum carrier protein; PDBTitle: crystal structure of putative molybdenum carrier protein (yp_461806.1)2 from syntrophus aciditrophicus sb at 1.45 a resolution
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210.........220.........230.........240.........250.....
Predicted Secondary structure 


















































Query SS confidence 







































































Query Sequence  KWPEIQAEMRIWKKRREGERKETGKYTSVVDLARARANQQYTENSTGKISPVIAAIHREYKQTWKTLDDELA
Query Conservation    
 
  
   
    

 

         
 
            
   
   
   
 








 


Alig confidence 













......................



















...












Template Conservation      
   
  

 ......................   
 










 


...
     

   

Template Sequence  SIEDAATLINSWTV. . . . . . . . . . . . . . . . . . . . . . SHHIQVLNIAGPRAGKDPEI. . . YQATXDLLEVFLA
Template Known Secondary structure 
......................TT




TTT
TT...
Template Predicted Secondary structure 



......................












...
Template SS confidence 







































































   111........120.... .....130.........140.... .....150.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions