Return to main results Retrieve Phyre Job Id

Job DescriptionP31469
Confidence25.99%DateThu Jan 5 11:47:58 GMT 2012
Rank4Aligned Residues27
% Identity37%Templatec3kzqE_
PDB info PDB header:structural genomics, unknown functionChain: E: PDB Molecule:putative uncharacterized protein vp2116; PDBTitle: the crystal structure of the protein with unknown function from vibrio2 parahaemolyticus rimd 2210633
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90.........100.........110.......
Predicted Secondary structure 












































Query SS confidence 
































































Query Sequence  EHLCPWCIADGSAAEKFAGSFQDDASIEGVEFEYDEEDEFAGIKNTYPDEMLKELVERTPGYHGW
Query Conservation    








 

 



 
  
                             

  




 

Alig confidence 








......................................

















Template Conservation 
  

 
  ......................................    
  
         
Template Sequence  DPMCSWCWG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . YKPTIEKLKQQLPGVIQF
Template Known Secondary structure 
TT
......................................S
TT
Template Predicted Secondary structure 




......................................



Template SS confidence 
































































   10........ .20.........30......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions