Return to main results Retrieve Phyre Job Id

Job DescriptionP31469
Confidence7.00%DateThu Jan 5 11:47:58 GMT 2012
Rank82Aligned Residues29
% Identity21%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31..... ...40.........50... ......
Predicted Secondary structure 



........









.


Query SS confidence 





. . . . . . . .
















.





Query Sequence  CDCCEQ. . . . . . . . QTSVYYSGPFYCVDEVE. HLCPWC
Query Conservation 
 



........     


  
   

 . 




Alig confidence 





........
















.





Template Conservation 

 

               

    
       
  
Template Sequence  CPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHC
Template Known Secondary structure 
TTTSSSBTTTTT
Template Predicted Secondary structure 















Template SS confidence 





































   3......10.........20.........30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions