Return to main results Retrieve Phyre Job Id

Job DescriptionP31469
Confidence24.96%DateThu Jan 5 11:47:58 GMT 2012
Rank5Aligned Residues26
% Identity27%Templatec2aj2A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:hypothetical upf0301 protein vc0467; PDBTitle: x-ray crystal structure of protein vc0467 from vibrio2 cholerae. northeast structural genomics consortium target3 vcr8.
Resolution3.21 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   127..130.........140.........150.........160
Predicted Secondary structure 









Query SS confidence 

































Query Sequence  GDFCVFIGYVGWNDIKDRLDEFANLEEDCENFGI
Query Conservation   
 




 

  

                   
Alig confidence 















........









Template Conservation       






  

........

 

  
 
Template Sequence  EGYIVALGYSGWSAGQ. . . . . . . . LEVELTENSW
Template Known Secondary structure  SS
TT........TTTT
Template Predicted Secondary structure 





........



Template SS confidence 

































   135....140.........150 .........160
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions