Return to main results Retrieve Phyre Job Id

Job DescriptionP76256
Confidence32.02%DateThu Jan 5 12:21:17 GMT 2012
Rank181Aligned Residues29
% Identity21%Templatec3fimB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:aryl-alcohol oxidase; PDBTitle: crystal structure of aryl-alcohol-oxidase from pleurotus eryingii
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90
Predicted Secondary structure 









Query SS confidence 



































Query Sequence  DINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMI
Query Conservation 


 


  










 
 




  
 


 
Alig confidence 











.......
















Template Conservation 









  .......
   
  

   
  

Template Sequence  DFDYVVVGAGNA. . . . . . . GNVVAARLTEDPDVSVL
Template Known Secondary structure 
S

STT.......TTSTT

Template Predicted Secondary structure 





.......



Template SS confidence 



































   2.......10... ......20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions