Return to main results Retrieve Phyre Job Id

Job DescriptionP76256
Confidence31.97%DateThu Jan 5 12:21:17 GMT 2012
Rank183Aligned Residues27
% Identity22%Templatec1ju2A_
PDB info PDB header:lyaseChain: A: PDB Molecule:hydroxynitrile lyase; PDBTitle: crystal structure of the hydroxynitrile lyase from almond
Resolution1.47 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   57..60.........70.........80.........90
Predicted Secondary structure 








Query SS confidence 

































Query Sequence  NALAYGRGPGSFTGVRIGIGIAQGLALGAELPMI
Query Conservation 
 


  










 
 




  
 


 
Alig confidence 









.......
















Template Conservation 







 
.......
   
  

 
 




Template Sequence  DYVIVGGGTS. . . . . . . GCPLAATLSEKYKVLVL
Template Known Secondary structure 

STT.......TTTS
Template Predicted Secondary structure 



.......


Template SS confidence 

































   28.30....... ..40.........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions