Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF56
Confidence32.26%DateThu Jan 5 11:25:16 GMT 2012
Rank107Aligned Residues46
% Identity28%Templated1iipa1
SCOP infoalpha-alpha superhelix TPR-like Tetratricopeptide repeat (TPR)
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30 .........40.........50.......
Predicted Secondary structure 


..................





Query SS confidence 


















. . . . . . . . . . . . . . . . . .


























Query Sequence  TFFAHANDSEPGSQYLKAA. . . . . . . . . . . . . . . . . . EAGDRRAQYFLADSWFSSGDLSKAEYW
Query Conservation        
  

   
 


..................  
   
   

  
  
 
   
   
Alig confidence 


















..................


























Template Conservation    

 
 
  
   
  

            
              
 
 
 


  
  

  
Template Sequence  TFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDS
Template Known Secondary structure  TT
Template Predicted Secondary structure 












Template SS confidence 































































   232.......240.........250.........260.........270.........280.........290.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions