Return to main results Retrieve Phyre Job Id

Job DescriptionQ5H776
Confidence27.06%DateThu Jan 5 12:37:21 GMT 2012
Rank189Aligned Residues42
% Identity10%Templatec3o8nA_
PDB info PDB header:transferaseChain: A: PDB Molecule:6-phosphofructokinase, muscle type; PDBTitle: structure of phosphofructokinase from rabbit skeletal muscle
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110.........120..
Predicted Secondary structure 


























Query SS confidence 


























































Query Sequence  GIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMAIINAALERRIPIFAICRGLQELVV
Query Conservation 



 

     
               
      

  
     





 
 


  
Alig confidence 











.................





























Template Conservation   

  

 


 .................

 
  

  
   
  
 
   
  

  
Template Sequence  AVMNVGAPAAGM. . . . . . . . . . . . . . . . . NAAVRSTVRIGLIQGNRVLVVHDGFEGPAK
Template Known Secondary structure  SS

TT.................T
SSTT
Template Predicted Secondary structure 




.................








Template SS confidence 


























































   404.....410..... ....420.........430.........440.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions