Return to main results Retrieve Phyre Job Id

Job DescriptionP77657
Confidence5.30%DateThu Jan 5 12:31:25 GMT 2012
Rank28Aligned Residues30
% Identity3%Templatec3ugsB_
PDB info PDB header:transferaseChain: B: PDB Molecule:undecaprenyl pyrophosphate synthase; PDBTitle: crystal structure of a probable undecaprenyl diphosphate synthase2 (upps) from campylobacter jejuni
Resolution2.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   110.........120.........130.........140.......
Predicted Secondary structure 














Query SS confidence 





































Query Sequence  HICLLFNKDAYYHLGDYDQDDNLRGMITGAWYSALRLE
Query Conservation 
  
 


      
       
   
  

  
    
Alig confidence 








......











..








Template Conservation 








......

 
   
  

.. 

   

 
Template Sequence  HLAVVMDGN. . . . . . RSQGVKTMQKLM. . EVCMEENIS
Template Known Secondary structure 


......

..TT

Template Predicted Secondary structure 


........



Template SS confidence 





































   6...10.... .....20...... ...30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions