Return to main results Retrieve Phyre Job Id

Job DescriptionP77657
Confidence73.78%DateThu Jan 5 12:31:25 GMT 2012
Rank2Aligned Residues55
% Identity15%Templatec2ns6A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:mobilization protein a; PDBTitle: crystal structure of the minimal relaxase domain of moba2 from plasmid r1162
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.........80.........90.........100.........110...
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  IAVRVDLHYPKIVDNGDNICCFPNLEPGVISRMRESLRAKLEADRTRKVREDKRIYRCPLFIIWAKEYSESGKCHYHICL
Query Conservation 
 




  
                   



  


 

                    


 

       


  
Alig confidence 













........
















.................























Template Conservation   

   



 

 ........ 
    
   
      .................  
   
 


 
   


 


 
Template Sequence  LFKEVEFALPVELT. . . . . . . . LDQQKALASEFAQHLTG. . . . . . . . . . . . . . . . . AERLPYTLAIHAGGGENPHCHLMI
Template Known Secondary structure 


TTS
........T.................TTT

TTT
Template Predicted Secondary structure 





........

.................









Template SS confidence 















































































   71........80.... .....90.........100. ........110.........120.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions