Return to main results Retrieve Phyre Job Id

Job DescriptionP42641
Confidence91.58%DateThu Jan 5 12:02:02 GMT 2012
Rank464Aligned Residues28
% Identity11%Templatec3lncB_
PDB info PDB header:transferaseChain: B: PDB Molecule:guanylate kinase; PDBTitle: crystal structure of guanylate kinase from anaplasma2 phagocytophilum
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   162.......170.........180.........190......
Predicted Secondary structure 

















Query SS confidence 


































Query Sequence  VGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVP
Query Conservation 




 









 

  
  

  




 
Alig confidence 















.......











Template Conservation 


 



 




  .......
   
  


  
Template Sequence  LVLSSPSTVANKLLEN. . . . . . . IVKSVSVTTRAA
Template Known Secondary structure 





.......



S

Template Predicted Secondary structure 





.......








Template SS confidence 


































   910.........20.... .....30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions