Return to main results Retrieve Phyre Job Id

Job DescriptionP42641
Confidence98.44%DateThu Jan 5 12:02:02 GMT 2012
Rank266Aligned Residues42
% Identity29%Templatec1t9hA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:probable gtpase engc; PDBTitle: the crystal structure of yloq, a circularly permuted gtpase.
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   162.......170.........180.........190.........200.........210.........
Predicted Secondary structure 


























Query SS confidence 

























































Query Sequence  VGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEKSFVVADIPGLIE
Query Conservation 




 









 

  
  

  




 
  
 
       
 
 





 
Alig confidence 

















...........










..



...








Template Conservation      
 









 
...........  
        .. 
  ...





   
Template Sequence  TVFAGQSGVGKSSLLNAI. . . . . . . . . . . SPTRHVELIHT. . SGGL. . . VADTPGFSS
Template Known Secondary structure  S...........






..TT...SS
S
SS
Template Predicted Secondary structure 





...........




..


...


Template SS confidence 

























































   167..170.........180.... .....190..... .... 200........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions