Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAX8
Confidence4.84%DateThu Jan 5 11:14:05 GMT 2012
Rank55Aligned Residues27
% Identity22%Templatec3dsmA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein bacuni_02894; PDBTitle: crystal structure of the surface layer protein bacuni_02894 from2 bacteroides uniformis, northeast structural genomics consortium3 target btr193d.
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   109110.........120.........130.........140.
Predicted Secondary structure 













Query SS confidence 
































Query Sequence  RLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTK
Query Conservation 


 
      
 
 


 
  
  

 
   
Alig confidence 



















......






Template Conservation   
 
    
  
  
 

  ......
 
    
Template Sequence  IVYRYSPQGKLIDEFYVGII. . . . . . PGAFCWK
Template Known Secondary structure 
TT

S......
Template Predicted Secondary structure 








......

Template SS confidence 
































   308.310.........320....... ..330....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions