Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAX8
Confidence3.02%DateThu Jan 5 11:14:05 GMT 2012
Rank99Aligned Residues27
% Identity19%Templatec1yd7A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-keto acid:ferredoxin oxidoreductase subunit PDBTitle: conserved hypothetical protein pfu-1647980-001 from2 pyrococcus furiosus
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   208.210.........220..... ....230....
Predicted Secondary structure 




........



Query SS confidence 

















. . . . . . . .








Query Sequence  HGCVRLRNEDIKFLFEKV. . . . . . . . PVGTRVQFI
Query Conservation 





   

  

  
........  



 
 
Alig confidence 

















........








Template Conservation   
  

 
   

  
    

 


    


  
Template Sequence  HSLIVLSPSTVQEAFDFTIRAFNLSEKYRTPVILL
Template Known Secondary structure 





STS
Template Predicted Secondary structure 






Template SS confidence 


































   142.......150.........160.........170......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions