Return to main results Retrieve Phyre Job Id

Job DescriptionP30136
Confidence58.39%DateThu Jan 5 11:45:53 GMT 2012
Rank88Aligned Residues43
% Identity12%Templatec3p6lA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:sugar phosphate isomerase/epimerase; PDBTitle: crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903)2 from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   313......320.........330.........340.........350.........360.........370.........380.........390..
Predicted Secondary structure 

















Query SS confidence 















































































Query Sequence  EAFRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAAYDVSLSL
Query Conservation 
     

 

  



 


 

          
  








 
 


    




  

 



   






Alig confidence 






















.....................................



















Template Conservation        
  
  

         .....................................   
      
   

 
 
Template Sequence  SDWEKXFKFAKAXDLEFITCEPA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LSDWDLVEKLSKQYNIKISV
Template Known Secondary structure  TTT
S


.....................................GGGT
Template Predicted Secondary structure 





.....................................


Template SS confidence 















































































   113......120.........130..... ....140.........150.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions