Return to main results Retrieve Phyre Job Id

Job DescriptionP30136
Confidence20.67%DateThu Jan 5 11:45:53 GMT 2012
Rank234Aligned Residues50
% Identity22%Templatec3nm3D_
PDB info PDB header:transferaseChain: D: PDB Molecule:thiamine biosynthetic bifunctional enzyme; PDBTitle: the crystal structure of candida glabrata thi6, a bifunctional enzyme2 involved in thiamin biosyhthesis of eukaryotes
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   315....320.........330.........340.........350.........360.........370.........380.........390....
Predicted Secondary structure 



















Query SS confidence 















































































Query Sequence  FRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAAYDVSLSLGD
Query Conservation      

 

  



 


 

          
  








 
 


    




  

 



   








Alig confidence 



















..............................





























Template Conservation      

 

  

  



 ..............................
     
    
  
  
     
 




Template Sequence  LYGQVEAGLQNGVTLVQIRE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KDADTKFFIEEALQIKELCHAHNVPLIIND
Template Known Secondary structure  SS



..............................SSS
TTTT

S
Template Predicted Secondary structure 





..............................






Template SS confidence 















































































   27..30.........40...... ...50.........60.........70......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions