Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC33
Confidence16.84%DateThu Jan 5 11:17:04 GMT 2012
Rank73Aligned Residues29
% Identity24%Templatec2jmbA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein atu4866; PDBTitle: solution structure of the protein atu4866 from agrobacterium2 tumefaciens
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   320.........330....... ..340........
Predicted Secondary structure 




.............






Query SS confidence 

















. . . . . . . . . . . . .










Query Sequence  ADRNIKAKINRQGIWIEK. . . . . . . . . . . . . LEHNPGKYIPE
Query Conservation 
 


   
   
     .............    
     
Alig confidence 

















.............










Template Conservation   

 




  



 



 
  

 


 
 
  
 
 

Template Sequence  ADGRIRQELLPNGRYDEARGNRKSAYQGRYEVRGAHINYWDD
Template Known Secondary structure  SSSSTTTTTTTB
T
Template Predicted Secondary structure 

















Template SS confidence 









































   12.......20.........30.........40.........50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions