Return to main results Retrieve Phyre Job Id

Job DescriptionP37057
Confidence72.34%DateThu Jan 5 11:54:46 GMT 2012
Rank19Aligned Residues26
% Identity35%Templatec2qa4Z_
PDB info PDB header:ribosomeChain: Z: PDB Molecule:50s ribosomal protein l37ae; PDBTitle: a more complete structure of the the l7/l12 stalk of the2 haloarcula marismortui 50s large ribosomal subunit
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........
Predicted Secondary structure 














Query SS confidence 



































Query Sequence  CPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATF
Query Conservation 

 

  
 



   
   
  
 

 
  

 

Alig confidence 















........




..




Template Conservation 

 


  


   

........
 
 
..

   
Template Sequence  CPNCGEDRVDRQGTGI. . . . . . . . WQCSY. . CDYKF
Template Known Secondary structure 
SSSS
S

SSS........TT..T

Template Predicted Secondary structure 






........

..


Template SS confidence 



































   3940.........50.... ..... 60....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions