Return to main results Retrieve Phyre Job Id

Job DescriptionP37057
Confidence40.14%DateThu Jan 5 11:54:46 GMT 2012
Rank40Aligned Residues26
% Identity27%Templatec2gajA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:dna topoisomerase i; PDBTitle: structure of full length topoisomerase i from thermotoga maritima in2 monoclinic crystal form
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........
Predicted Secondary structure 














Query SS confidence 



































Query Sequence  CPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATF
Query Conservation 

 

  
 



   
   
  
 

 
  

 

Alig confidence 

.











......





...





Template Conservation 

.

  
     
 ......
 
  
... 
    
Template Sequence  CS. CGKEMRLSFGKY. . . . . . GFYLKC. . . ECGKTR
Template Known Secondary structure 
S.SS
TT......
...SSS

Template Predicted Secondary structure 

.






......

...


Template SS confidence 



































   559560 .........570.. ...... .580....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions