Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFL9
Confidence59.32%DateThu Jan 5 11:26:42 GMT 2012
Rank88Aligned Residues30
% Identity17%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13.... ..20....... ..30.........40..
Predicted Secondary structure 




..






............








Query SS confidence 




. .









. . . . . . . . . . . .














Query Sequence  CSQCD. . MLVALPRLEH. . . . . . . . . . . . GQKAACPRCGTTLTV
Query Conservation 
  

.. 
     
  ............
  
 




  
  
Alig confidence 




..









............














Template Conservation 

 

               

    
       
  


    
Template Sequence  CPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMN
Template Known Secondary structure 
TTTSSSBTTTTT



Template Predicted Secondary structure 


















Template SS confidence 











































   3......10.........20.........30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions