Return to main results Retrieve Phyre Job Id

Job DescriptionP76148
Confidence6.66%DateThu Jan 5 12:19:42 GMT 2012
Rank89Aligned Residues31
% Identity26%Templatec3tqcB_
PDB info PDB header:transferaseChain: B: PDB Molecule:pantothenate kinase; PDBTitle: structure of the pantothenate kinase (coaa) from coxiella burnetii
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   85....90.........100....... ..110.......
Predicted Secondary structure 









...............
Query SS confidence 






















. . . . . . . . . . . . . . .









Query Sequence  AKWHNIPQGVSLSEEQQRYIVAV. . . . . . . . . . . . . . . IYHWLVVQMN
Query Conservation   


 

 

 

  

 


 
...............
  

   
 
Alig confidence 








..











...............









Template Conservation    
  
   ..
       
  


 
    
 

  

   
     
Template Sequence  QQWGNFPLT. . LTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVT
Template Known Secondary structure  T



..

TTTT
T
Template Predicted Secondary structure 
..






Template SS confidence 















































   1920....... ..30.........40.........50.........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions