Return to main results Retrieve Phyre Job Id

Job DescriptionP76148
Confidence17.25%DateThu Jan 5 12:19:42 GMT 2012
Rank23Aligned Residues20
% Identity25%Templatec2kreA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:ubiquitin conjugation factor e4 b; PDBTitle: solution structure of e4b/ufd2a u-box domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   57..60.........70.........80.......
Predicted Secondary structure 











Query SS confidence 






























Query Sequence  NDGKQTPMRGHPVFIAQHATATCCRGCLAKW
Query Conservation 













 









 

 

Alig confidence 






.


..........









Template Conservation   


  
. 
 ..........
  
  
   
Template Sequence  TDPVRLP. SGT. . . . . . . . . . IMDRSIILRH
Template Known Secondary structure  SST.TT..........
Template Predicted Secondary structure 


.


..........
Template SS confidence 






























   1242...... .1250. ........1260.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions