Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6P5
Confidence96.44%DateThu Jan 5 11:03:38 GMT 2012
Rank363Aligned Residues38
% Identity21%Templatec2d62A_
PDB info PDB header:sugar binding proteinChain: A: PDB Molecule:multiple sugar-binding transport atp-binding PDBTitle: crystal structure of multiple sugar binding transport atp-2 binding protein
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50...
Predicted Secondary structure 
















Query SS confidence 

















































Query Sequence  VVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGRAEIEGREFI
Query Conservation   
 


  






 
 
     
 
    
 


              
Alig confidence 























............













Template Conservation     
 
 








  
 
   ............   
 
   
    
Template Sequence  FLVLLGPSGCGKTTTLRXIAGLEE. . . . . . . . . . . . PTRGQIYIEDNLVA
Template Known Secondary structure 
STTSSTSS
............
STT
Template Predicted Secondary structure 









............







Template SS confidence 

















































   34.....40.........50....... ..60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions