Return to main results Retrieve Phyre Job Id

Job DescriptionP10031
Confidence9.32%DateThu Jan 5 11:32:00 GMT 2012
Rank28Aligned Residues27
% Identity15%Templatec2wmhA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:fucolectin-related protein; PDBTitle: crystal structure of the catalytic module of a family 982 glycoside hydrolase from streptococcus pneumoniae tigr4 in3 complex with the h-disaccharide blood group antigen.
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   85....90.........100.........110.........120.....
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  QVWVLVLVNAGGEPFAVVQVQRRFASEAVSHSLALAASLDT
Query Conservation 
 
 


   


  
 
   
 
 

 

  

  
   
Alig confidence 












.......






.......






Template Conservation   
  


  
 
 ....... 
  
  .......  

 

Template Sequence  NIPVFLVIMSAGE. . . . . . . RNTVPPE. . . . . . . WLDEQFQ
Template Known Secondary structure  T

TT
.......SS


.......
Template Predicted Secondary structure 







.......




.......
Template SS confidence 








































   120.........130.. ....... 140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions