Return to main results Retrieve Phyre Job Id

Job DescriptionP10031
Confidence7.66%DateThu Jan 5 11:32:00 GMT 2012
Rank36Aligned Residues30
% Identity30%Templatec1vq0A_
PDB info PDB header:chaperoneChain: A: PDB Molecule:33 kda chaperonin; PDBTitle: crystal structure of 33 kda chaperonin (heat shock protein 33 homolog)2 (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.........
Predicted Secondary structure 













Query SS confidence 




















































Query Sequence  LNVLQTMNAQEYEDIRAAGSDERRELTHAVMRELDAPDNWTMNGEYGSEFGGF
Query Conservation 
  
 

 
 
 
  
  
 
 

 

 

   
  
 

  



 





Alig confidence 


















.......................










Template Conservation     
  

  

  
  

....................... 


 
 

  
Template Sequence  KNALLVLDKKELEDMRKEG. . . . . . . . . . . . . . . . . . . . . . . KGEVVCKWCNT
Template Known Secondary structure  TS
T.......................

TTT

Template Predicted Secondary structure 



.......................




Template SS confidence 




















































   239240.........250....... ..260........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions