Return to main results Retrieve Phyre Job Id

Job DescriptionP10031
Confidence4.99%DateThu Jan 5 11:32:00 GMT 2012
Rank66Aligned Residues36
% Identity31%Templatec1cz7C_
PDB info PDB header:contractile proteinChain: C: PDB Molecule:microtubule motor protein ncd; PDBTitle: the crystal structure of a minus-end directed microtubule2 motor protein ncd reveals variable dimer conformations
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60........
Predicted Secondary structure 











Query SS confidence 




















































Query Sequence  QEYEDIRAAGSDERRELTHAVMRELDAPDNWTMNGEYGSEFGGFFPVQVRFTP
Query Conservation   
 
  
  
 
 

 

 

   
  
 

  



 














Alig confidence 





















.................













Template Conservation               

 
 
 
 .................







  



Template Sequence  ETCKEQLFQSNMERKELHNTVM. . . . . . . . . . . . . . . . . DLRGNIRVFCRIRP
Template Known Secondary structure  .................
S

Template Predicted Secondary structure  .................







Template SS confidence 




















































   322.......330.........340... ......350.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions