Return to main results Retrieve Phyre Job Id

Job DescriptionP39293
Confidence16.89%DateThu Jan 5 11:59:00 GMT 2012
Rank2Aligned Residues44
% Identity16%Templatec3alxB_
PDB info PDB header:viral protein/membrane proteinChain: B: PDB Molecule:hemagglutinin, cdw150; PDBTitle: crystal structure of the measles virus hemagglutinin bound to its2 cellular receptor slam (mv-h(l482r)-slam(n102h/r108y) fusion)
Resolution3.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   147..150.........160.........170.........180.........190.........200.........210.
Predicted Secondary structure 



























Query SS confidence 
































































Query Sequence  EPVYMLEKVENQNHAKWEVHNFTMGYQRQVTEDTYEYLLLNGEESFNDLGEPEWLFSRALGVDIP
Query Conservation   

   
 
 
     
 
 
  


 
 
     
 


  

           
   


 
 
Alig confidence 
















.












....................













Template Conservation   

 





 
  


.
 
 
 
  
 
 ....................
 
   




 

Template Sequence  VPIELQVECFTWDQKLW. CRHFCVLADSESG. . . . . . . . . . . . . . . . . . . . GHITHSGMVGMGVS
Template Known Secondary structure 



SSS.


SSSS....................


Template Predicted Secondary structure 




.



....................


Template SS confidence 
































































   562.......570........ .580.........590. ........600.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions