Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE95
Confidence2.73%DateThu Jan 5 11:22:49 GMT 2012
Rank53Aligned Residues26
% Identity27%Templatec3da4B_
PDB info PDB header:antibioticChain: B: PDB Molecule:colicin-m; PDBTitle: crystal structure of colicin m, a novel phosphatase2 specifically imported by escherichia coli
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   80.........90.........100.........110.
Predicted Secondary structure 



Query SS confidence 































Query Sequence  DVIFQTFLFPLKRDFEKTVVFALIQTEEALNR
Query Conservation    



 
 
    
   

 

  
   
 
Alig confidence 










......














Template Conservation             ......               
Template Sequence  QVVYSFFQSPN. . . . . . MCLQALTQLEDYIKK
Template Known Secondary structure  S......
Template Predicted Secondary structure 



......
Template SS confidence 































   3940......... 50.........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions