Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6W5
Confidence29.99%DateWed Jan 25 15:20:16 GMT 2012
Rank45Aligned Residues43
% Identity28%Templated1st6a3
SCOP infoFour-helical up-and-down bundle alpha-catenin/vinculin-like alpha-catenin/vinculin
Resolution3.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60.........70..
Predicted Secondary structure 








Query SS confidence 





























































Query Sequence  AEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAAREQQGFCEGRIKDIEAKLSNA
Query Conservation     
  

  
    
         

  


 




 


     

 

  
   
  
Alig confidence 











.............








......





















Template Conservation 
  

  

 

.............  
 
 


......
  

 

   
  
   
  
Template Sequence  LGQMTDQLADLR. . . . . . . . . . . . . ARGQGATPM. . . . . . AMQKAQQVSQGLDLLTAKVENA
Template Known Secondary structure  T.............TTT



......TT
Template Predicted Secondary structure  .............





......
Template SS confidence 





























































   328.330......... 340........ .350.........360.........370
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions