Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6W5
Confidence16.76%DateWed Jan 25 15:20:16 GMT 2012
Rank74Aligned Residues36
% Identity17%Templatec2xznY_
PDB info PDB header:ribosomeChain: Y: PDB Molecule:rps6e; PDBTitle: crystal structure of the eukaryotic 40s ribosomal2 subunit in complex with initiation factor 1. this file3 contains the 40s subunit and initiation factor for4 molecule 2
Resolution3.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   91........100.........110.........120.........130.........140
Predicted Secondary structure 
























Query SS confidence 

















































Query Sequence  TVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVVV
Query Conservation   
 
 
          


  
 
     

  



 



   

 
 
Alig confidence 























..............











Template Conservation 




 
 

     

 
     .............. 
 




 


Template Sequence  KFNISYPLTGAQKCIEIDDDKKCN. . . . . . . . . . . . . . IFMDKKMGQEVE
Template Known Secondary structure  TTTT

ST..............TTTT

TT
Template Predicted Secondary structure 








..............






Template SS confidence 

















































   2.......10.........20..... ....30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions