Return to main results Retrieve Phyre Job Id

Job DescriptionP36682
Confidence6.15%DateThu Jan 5 11:53:47 GMT 2012
Rank72Aligned Residues33
% Identity33%Templatec3lkxB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:nascent polypeptide-associated complex subunit alpha; PDBTitle: human nac dimerization domain
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   195....200.........210.........220.........230.........240.........250........
Predicted Secondary structure 

















































Query SS confidence 































































Query Sequence  KVITTTKKAVPVKQTVTAPVIPSNTVLTANPVITEPATTVISIEPANPDVVYIPNYNPTVVYGN
Query Conservation   
                                      
 
        


 
        
Alig confidence 








...............................























Template Conservation 





 
 ............................... 



  






 
 






Template Sequence  RVTIRKSKN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ILFVITKPDVYKSPASDTYIVFGE
Template Known Secondary structure  TTT...............................S

TTSS
S
Template Predicted Secondary structure 

...............................









Template SS confidence 































































   34.....40.. .......50.........60......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions