Return to main results Retrieve Phyre Job Id

Job DescriptionP36682
Confidence5.69%DateThu Jan 5 11:53:47 GMT 2012
Rank80Aligned Residues28
% Identity25%Templatec2xqoA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:cellulosome enzyme, dockerin type i; PDBTitle: ctcel124: a cellulase from clostridium thermocellum
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   100.........110.........120.........130....
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  STYPTNVAQAVQWSHDNPLKQGDAAIQAVSDQPWD
Query Conservation     
     
                       

Alig confidence 

























.......

Template Conservation    



  
    
    

 
  

.......
 
Template Sequence  VRYADETAALGAWYLRNNHXSDDEFT. . . . . . . WD
Template Known Secondary structure  TT
SSSS


.......
T
Template Predicted Secondary structure 






.......
Template SS confidence 


































   201........210.........220...... ..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions