Return to main results Retrieve Phyre Job Id

Job DescriptionP77147
Confidence11.15%DateThu Jan 5 12:25:38 GMT 2012
Rank61Aligned Residues20
% Identity35%Templatec1ceuA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:protein (hiv-1 regulatory protein n-terminal PDBTitle: nmr structure of the (1-51) n-terminal domain of the hiv-12 regulatory protein
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50........
Predicted Secondary structure 








Query SS confidence 




































Query Sequence  LRHFPRGGSYADIHHALIEEGYTDWAESLVEYAWKKW
Query Conservation                  
                    
Alig confidence 




.................














Template Conservation   



.................
 

  
  

    
Template Sequence  VRHFP. . . . . . . . . . . . . . . . . RIWLHSLGQHIYETY
Template Known Secondary structure  TTS
.................T

Template Predicted Secondary structure 

.................
Template SS confidence 




































   31.... ....40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions