Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA41
Confidence3.29%DateThu Jan 5 11:11:52 GMT 2012
Rank90Aligned Residues25
% Identity20%Templatec2ov2O_
PDB info PDB header:protein binding/transferaseChain: O: PDB Molecule:serine/threonine-protein kinase pak 4; PDBTitle: the crystal structure of the human rac3 in complex with the crib2 domain of human p21-activated kinase 4 (pak4)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   202.......210.........220.........230.
Predicted Secondary structure 









Query SS confidence 





























Query Sequence  HASQLSLTHPFTGEPLTIHAGLDDTWMQAL
Query Conservation 

  
 
  
  
      



      
Alig confidence 







.






....









Template Conservation 
  




.  

 
 ....


  
  

Template Sequence  HRVHTGFD. QHEQKFT. . . . GLPRQWQSLI
Template Known Secondary structure 




.TTTT....S

GGGTTT
Template Predicted Secondary structure  .



....



Template SS confidence 





























   1920...... ...30... ......40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions