Return to main results Retrieve Phyre Job Id

Job DescriptionP64548
Confidence3.87%DateThu Jan 5 12:09:21 GMT 2012
Rank60Aligned Residues41
% Identity24%Templatec3fpjA_
PDB info PDB header:biosynthetic protein, transferaseChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: crystal structure of e81q mutant of mtnas in complex with s-2 adenosylmethionine
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93......100.........110.........120.........130.........140.........150.........160.........
Predicted Secondary structure 























Query SS confidence 












































































Query Sequence  NGFYFGNESPTFQMELTEQYPSKALLLIAEQNTECIIGSAFCLIIHNNDVRFAVNLDALSRSGVKVNPDVLMLARKK
Query Conservation   



          

  
   






   
   

 
 
     



 


      

 





 


  
Alig confidence 
























....................................















Template Conservation 


 








   

   
  
.................................... 



   





  
Template Sequence  RAVFIGGGPLPLTGILLSHVYGMRV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NVVEIEPDIAELSRKV
Template Known Secondary structure 


SS
TT

....................................S
Template Predicted Secondary structure 







....................................

Template SS confidence 












































































   125....130.........140......... 150.........160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions