Return to main results Retrieve Phyre Job Id

Job DescriptionP39163
Confidence20.57%DateThu Jan 5 11:58:18 GMT 2012
Rank26Aligned Residues19
% Identity21%Templated2v6ai1
SCOP infoRuBisCO, small subunit RuBisCO, small subunit RuBisCO, small subunit
Resolution1.5

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   162.......170.........180.........190.
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  YESDTRAQVIAPLIAAASGPLGTNAQYLFS
Query Conservation 
 
    
 

  

 
 
 

 
 


  
Alig confidence 













...........




Template Conservation 









 


........... 


 
Template Sequence  YLPPLTDEQIAAQV. . . . . . . . . . . DYIVA
Template Known Secondary structure  TSS


...........
Template Predicted Secondary structure 





...........
Template SS confidence 





























   17..20.........30 .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions