Return to main results Retrieve Phyre Job Id

Job DescriptionP39163
Confidence10.49%DateThu Jan 5 11:58:18 GMT 2012
Rank66Aligned Residues37
% Identity16%Templatec2jfzB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:glutamate racemase; PDBTitle: crystal structure of helicobacter pylori glutamate racemase2 in complex with d-glutamate and an inhibitor
Resolution1.86 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   151........160.........170.........180.........190.........200..
Predicted Secondary structure 























Query SS confidence 



















































Query Sequence  IVFIMDPRHPEYESDTRAQVIAPLIAAASGPLGTNAQYLFSLEQELIKLGMQ
Query Conservation 
 


   
  
 
    
 

  

 
 
 

 
 


  
   

  

 
Alig confidence 











.







..............
















Template Conservation   

  
    

.
 

   
..............          
   


Template Sequence  IIYYGDSARVPY. GTKDPTTI. . . . . . . . . . . . . . KQFGLEALDFFKPHEIE
Template Known Secondary structure 
TTT


.TTS
..............GGGT
S
Template Predicted Secondary structure 






.



..............



Template SS confidence 



















































   28.30......... 40....... ..50.........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions