Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6F1
Confidence27.55%DateThu Jan 5 11:02:59 GMT 2012
Rank436Aligned Residues30
% Identity27%Templatec3e5nA_
PDB info PDB header:ligaseChain: A: PDB Molecule:d-alanine-d-alanine ligase a; PDBTitle: crystal strucutre of d-alanine-d-alanine ligase from2 xanthomonas oryzae pv. oryzae kacc10331
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   190.........200. ........210.........
Predicted Secondary structure 





..........



Query SS confidence 











. . . . . . . . . .

















Query Sequence  LPFHVVAYDFGA. . . . . . . . . . KRNILRMLVDRGCRLTIV
Query Conservation      
 


 
 ..........
 

 
 
   
  
 

Alig confidence 











..........

















Template Conservation   
 

 

 

 
 
  

  

  
  

   
  
  
Template Sequence  RKIRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLI
Template Known Secondary structure 


SSTTS
TTT
Template Predicted Secondary structure 










Template SS confidence 







































   2.......10.........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions