Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6F1
Confidence47.75%DateThu Jan 5 11:02:59 GMT 2012
Rank268Aligned Residues28
% Identity21%Templatec2i80B_
PDB info PDB header:ligaseChain: B: PDB Molecule:d-alanine-d-alanine ligase; PDBTitle: allosteric inhibition of staphylococcus aureus d-alanine:d-alanine2 ligase revealed by crystallographic studies
Resolution2.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200 .........210.........
Predicted Secondary structure 



...........




Query SS confidence 









. . . . . . . . . . .


















Query Sequence  PFHVVAYDFG. . . . . . . . . . . AKRNILRMLVDRGCRLTIV
Query Conservation     
 


 
........... 
 

 
 
   
  
 

Alig confidence 






.

...........


















Template Conservation 
  
 

. 

 
 
  


 

  
  

   
  
  
Template Sequence  KENICIV. FGGKSAEHEVSILTAQNVLNAIDKDKYHVDII
Template Known Secondary structure 
.
SSTTS
TTT
Template Predicted Secondary structure 

.






Template SS confidence 







































   3...... 10.........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions