Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6F1
Confidence31.73%DateThu Jan 5 11:02:59 GMT 2012
Rank383Aligned Residues29
% Identity21%Templatec1ehiB_
PDB info PDB header:ligaseChain: B: PDB Molecule:d-alanine:d-lactate ligase; PDBTitle: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant2 leuconostoc mesenteroides
Resolution2.38 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   190.........200 .........210... ......
Predicted Secondary structure 




...........



.
Query SS confidence 










. . . . . . . . . . .












.





Query Sequence  LPFHVVAYDFG. . . . . . . . . . . AKRNILRMLVDRG. CRLTIV
Query Conservation      
 


 
........... 
 

 
 
   
.  
 

Alig confidence 







.

...........












.





Template Conservation   



 

. 

 
 
  

  

  
   
   
   
  
Template Sequence  TKKRVALI. FGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVF
Template Known Secondary structure 

.
SSTTTTSS
Template Predicted Secondary structure 


.







Template SS confidence 









































   402....... 410.........420.........430.........440..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions