Return to main results Retrieve Phyre Job Id

Job DescriptionP76272
Confidence35.17%DateThu Jan 5 12:21:28 GMT 2012
Rank16Aligned Residues52
% Identity25%Templatec1txkA_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:glucans biosynthesis protein g; PDBTitle: crystal structure of escherichia coli opgg
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110.........120.........130.........140.........150.........160.........170.........180...
Predicted Secondary structure 








































Query SS confidence 













































































Query Sequence  TQFWLVTPKASLAGVSGLDALVGGNYIGMMPGKGKEQDHFVALDTQPKYRLDNGDLMIHLQAPDLGSLNSGSLVYFRK
Query Conservation 
 



 


   




 




 

   

       
 

  

       
    
 
   


  
 

 

 
Alig confidence 














......................








....



























Template Conservation 
 



 
      
......................








....







 
 

  
  

 
 

 
 
Template Sequence  KEFWIERPKPTDKRL. . . . . . . . . . . . . . . . . . . . . . TIYALLDSP. . . . RATGAYKFVVXPGRDTVVDVQSKIYLRD
Template Known Secondary structure 


TT


......................T....T
SSSSS
Template Predicted Secondary structure 








......................


....








Template SS confidence 













































































   189190.........200... ......210.. .......220.........230.........240
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions