Return to main results Retrieve Phyre Job Id

Job DescriptionP30871
Confidence7.16%DateThu Jan 5 11:46:46 GMT 2012
Rank24Aligned Residues29
% Identity28%Templatec2imuA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:structural polyprotein (pp) p1; PDBTitle: nmr structure of pep46 from the infectious bursal disease2 virus (ibdv) in dodecylphosphocholin (dpc).
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   376...380.........390.........400.........410...
Predicted Secondary structure 


Query SS confidence 





































Query Sequence  IDSILLLAGYYDPVVAQAWLENWQGLHHAIATGQRIEI
Query Conservation 

  


 


  
     
  
  

  

   
  
Alig confidence 













.........














Template Conservation 













.........














Template Sequence  RIAVPVVSTLFPPA. . . . . . . . . APLAHAIGEGVDYLL
Template Known Secondary structure  S
SST.........TT
Template Predicted Secondary structure 


.........
Template SS confidence 





































   12.......20..... ....30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions