Return to main results Retrieve Phyre Job Id

Job DescriptionP21418
Confidence8.96%DateWed Jan 25 15:20:41 GMT 2012
Rank48Aligned Residues28
% Identity18%Templatec2gajA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:dna topoisomerase i; PDBTitle: structure of full length topoisomerase i from thermotoga maritima in2 monoclinic crystal form
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.... .....60...... ...70..
Predicted Secondary structure  .........


Query SS confidence 









. . .











. . . . . .





Query Sequence  NLSALEQDIT. . . NLEKAAALSIAR. . . . . . MITYPR
Query Conservation   
  
 
 

... 
     
 
  ......





Alig confidence 









...











......





Template Conservation   
  

  
    
 
   

 


 


   




Template Sequence  KTSTLQQEAYSKLGFSVSKTMMIAQQLYEGVETKDGH
Template Known Secondary structure 





SS
Template Predicted Secondary structure 











Template SS confidence 




































   246...250.........260.........270.........280..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions