Return to main results Retrieve Phyre Job Id

Job DescriptionP21418
Confidence11.41%DateWed Jan 25 15:20:41 GMT 2012
Rank38Aligned Residues26
% Identity38%Templatec1e17A_
PDB info PDB header:dna binding domainChain: A: PDB Molecule:afx; PDBTitle: solution structure of the dna binding domain of the human2 forkhead transcription factor afx (foxo4)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20..... ....30.........
Predicted Secondary structure 
.......
Query SS confidence 











. . . . . . .













Query Sequence  TDDELYEWMRQK. . . . . . . INAAQDLKWANEAR
Query Conservation 
  





  
.......
 
   

     
Alig confidence 











.......













Template Conservation 

 


  
   




         






Template Sequence  TLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIR
Template Known Secondary structure 
GGGTSTT
Template Predicted Secondary structure 















Template SS confidence 
































   119120.........130.........140.........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions