Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABJ6
Confidence5.18%DateThu Jan 5 11:15:38 GMT 2012
Rank16Aligned Residues29
% Identity31%Templatec3ajfA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:non-structural protein 3; PDBTitle: structural insigths into dsrna binding and rna silencing suppression2 by ns3 protein of rice hoja blanca tenuivirus
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   63......70.........80.........90.........100.
Predicted Secondary structure 






Query SS confidence 






































Query Sequence  VCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWN
Query Conservation    



       

  
  
   
  


 





  
Alig confidence 






















..........





Template Conservation 
 

  
 



 
 

 



 ..........





Template Sequence  HXFLQXIRKPDDPENLSVFLKSA. . . . . . . . . . IWXLSH
Template Known Secondary structure 



..........T
Template Predicted Secondary structure 





..........
Template SS confidence 






































   57..60.........70......... 80.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions