Return to main results Retrieve Phyre Job Id

Job DescriptionP10121
Confidence97.37%DateThu Jan 5 11:32:03 GMT 2012
Rank248Aligned Residues144
% Identity16%Templatec3qq5A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:small gtp-binding protein; PDBTitle: crystal structure of the [fefe]-hydrogenase maturation protein hydf
Resolution2.99 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   286...290.........300.........310.........320.........330.........340.........350.........360.....
Predicted Secondary structure 



























Query SS confidence 















































































Query Sequence  LNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIF
Query Conservation                
  
 




 



         
     

 
  
  

                         
Alig confidence 



























.................................










........
Template Conservation     
 
 
  
 


  










.................................



   
 

........
Template Sequence  YTMRLGFRRYIVVAGRRNVGKSSFMNAL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VGTDPVYKSME. . . . . . . .
Template Known Secondary structure 








S
STTTTTTTTSS.................................





........
Template Predicted Secondary structure 












.................................


........
Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions