Return to main results Retrieve Phyre Job Id

Job DescriptionP16688
Confidence22.37%DateWed Jan 25 15:20:39 GMT 2012
Rank19Aligned Residues24
% Identity38%Templatec2aklA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:phna-like protein pa0128; PDBTitle: solution structure for phn-a like protein pa0128 from2 pseudomonas aeruginosa
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   240.........250.........260.........270.
Predicted Secondary structure 













Query SS confidence 































Query Sequence  PCAICGSTHSYLDEVVLDDAGNRMFVCSDTDY
Query Conservation 

  


   




  

 
     


 
 
Alig confidence 










......

.


.







Template Conservation   

 
  
 

...... 
.   . 




  
Template Sequence  PCPQCNSEYTY. . . . . . ED. GAL. LVCPECAH
Template Known Secondary structure 

TTT




......
.SSS.TTTT
Template Predicted Secondary structure 








......
.


.


Template SS confidence 































   7..10....... .. 20.. .......30
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions