Return to main results Retrieve Phyre Job Id

Job DescriptionP03841
Confidence5.16%DateThu Jan 5 10:58:04 GMT 2012
Rank94Aligned Residues30
% Identity23%Templatec3msvB_
PDB info PDB header:protein bindingChain: B: PDB Molecule:nuclear import adaptor, nro1; PDBTitle: the hypoxic regulator of sterol synthesis nro1 is a nuclear import2 adaptor
Resolution2.18 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   255....260.........270.... .....280....
Predicted Secondary structure 





.................
Query SS confidence 



















. . . . . . . . . . . . . . . . .









Query Sequence  MLNDTESYFNTAIKNAVAKG. . . . . . . . . . . . . . . . . DVDKALKLLD
Query Conservation     





   
  


  .................

 


 

 
Alig confidence 



















.................









Template Conservation 
 

 
 
     
     

    
    



    
 
  
  
Template Sequence  VDPNTPAYYKLIAQEAVLNNYTTFAEYYMDLLDNVDDLINKASSWLN
Template Known Secondary structure 
STTS
T

Template Predicted Secondary structure 




Template SS confidence 














































   270.........280.........290.........300.........310......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions