Return to main results Retrieve Phyre Job Id

Job DescriptionP37197
Confidence42.95%DateThu Jan 5 11:55:03 GMT 2012
Rank137Aligned Residues25
% Identity24%Templatec2x3oB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:hypothetical protein pa0856; PDBTitle: crystal structure of the hypothetical protein pa0856 from2 pseudomonas aeruginosa
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   423......430.........440.........450..
Predicted Secondary structure 







Query SS confidence 





























Query Sequence  DGAVKLMLRYQVGKELPQEDVDDIVAFLHS
Query Conservation   


           

  
  





 
Alig confidence 








.....















Template Conservation       

  ..... 

  

     

 
Template Sequence  PELIKLYTT. . . . . NFTESELKDLNAFYQS
Template Known Secondary structure  .....S
S
Template Predicted Secondary structure  .....



Template SS confidence 





























   104.....110.. .......120........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions