Return to main results Retrieve Phyre Job Id

Job DescriptionP31434
Confidence24.80%DateThu Jan 5 11:47:24 GMT 2012
Rank183Aligned Residues55
% Identity24%Templatec3n12A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:chitinase a; PDBTitle: crystal stricture of chitinase in complex with zinc atoms from2 bacillus cereus nctu2
Resolution1.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   329330.........340.........350.........360.........370.........380.........390.........400........
Predicted Secondary structure 


























Query SS confidence 















































































Query Sequence  EGMIRRLKAKGLKICVWINPYIGQKSPVFKELQEKGYLLKRPDGSLWQWDKWQPGLAIYDFTNPDACKWYADKLKGLVAM
Query Conservation     
  
   
      
 
 
        
       

   
       
 
     




 
  

          
Alig confidence 

















..................................



























Template Conservation     
   
  
 





..................................

   
        
  
  
 
  
  
Template Sequence  KSDISYLKSKGKKVVLSI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GGQNGVVLLPDNAAKDRFINSIQSLIDK
Template Known Secondary structure  TT
..................................STT





S
Template Predicted Secondary structure 


..................................









Template SS confidence 















































































   8990.........100...... ...110.........120.........130....
 
   409410.......
Predicted Secondary structure  .




Query SS confidence  .








Query Sequence  . GVDCFKTDF
Query Conservation  .


  
 
 
Alig confidence  .








Template Conservation 









Template Sequence  YGFDGIDIDL
Template Known Secondary structure 

S
Template Predicted Secondary structure 









Template SS confidence 









   135....140....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions